| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Cdc20 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Cdc20 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Cdc20. This antibody reacts with human. The Cdc20 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, Cdc20 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: TPTKKEHQKAWALNLNGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKATPGSSRKTCRYIPSLPDRILDAPEIRNDY |
|---|
| Other Names | CDC20 cell division cycle 20 homolog, CDC20 cell division cycle 20 homolog (S. cerevisiae), cell division cycle 20 homolog (S. cerevisiae), cell division cycle protein 20 homolog, MGC102824, p55CDCS. cerevisiae, homolog) |
|---|
| Gene, Accession # | CDC20, Gene ID: 991, Accession: Q12834, SwissProt: Q12834 |
|---|
| Catalog # | NBP2-38750 |
|---|
| Price | |
|---|
| Order / More Info | Cdc20 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|