| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CDC16 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CDC16 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CDC16. This antibody reacts with human. The CDC16 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human CDC16 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KDKLKCYDFDVHTMKTLKNIISPPWDFREFEVEKQTAEETGLTPLETSRKTPDSRPSLEETFEIEMNESDMMLETSMSDHST |
|---|
| Other Names | ANAPC6subunit 6, CDC16 (cell division cycle 16, S. cerevisiae, homolog), CDC16 cell division cycle 16 homolog (S. cerevisiae), CDC16 homolog, CDC16Hs, cell division cycle 16 homolog (S. cerevisiae), cell division cycle protein 16 homolog, Cyclosome subunit 6 |
|---|
| Gene, Accession # | CDC16, Gene ID: 8881 |
|---|
| Catalog # | NBP1-89094 |
|---|
| Price | |
|---|
| Order / More Info | CDC16 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|