| Edit |   |
| Antigenic Specificity | GRAP |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The GRAP Antibody from Novus Biologicals is a rabbit polyclonal antibody to GRAP. This antibody reacts with rat. The GRAP Antibody has been validated for the following applications: Western Blot. |
| Immunogen | The immunogen for this antibody is Grap - middle region. Peptide sequence GDQVQHFKVLREASGKYFLWEEKFNSLNELVDFYRTTTIAKRRQIFLCDE. |
| Other Names | GRB2-related adapter protein, GRB2-related adaptor protein, growth factor receptor-bound protein 2-related adaptor protein, MGC64880 |
| Gene, Accession # | GRAP, Gene ID: 10750, Accession: NP_001020920 |
| Catalog # | NBP1-98421-20ul |
| Price | |
| Order / More Info | GRAP Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |