| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Granzyme M |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Granzyme M Antibody from Novus Biologicals is a rabbit polyclonal antibody to Granzyme M. This antibody reacts with human. The Granzyme M Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Granzyme M antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PSMVCLAADSKDQAPCKGDSGGPLVCGKGRVLAGVLSFSSRVCTDIFKPP VATAVAPYVSWIRKVTGR |
|---|
| Other Names | EC 3.4.21, EC 3.4.21.-, granzyme M, granzyme M (lymphocyte met-ase 1), Hu-Met-1, LMET1, lymphocyte met-ase 1, Met-1 serine protease, MET1met-ase, Met-ase, Natural killer cell granular protease |
|---|
| Gene, Accession # | GZMM, Gene ID: 3004 |
|---|
| Catalog # | NBP2-14079 |
|---|
| Price | |
|---|
| Order / More Info | Granzyme M Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|