| 产品详情 |
| Edit |   |
| Antigenic Specificity | NMNAT-1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The NMNAT-1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NMNAT-1. This antibody reacts with human. The NMNAT-1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human NMNAT-1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LIPAYHRVIMAELATKNSKWVEVDTWESLQKEWKETLKVLRHHQEKLEASDCDHQQNSPTLERPGRKRKWTETQD |
| Other Names | EC 2.7.7.1, EC 2.7.7.18, NaMN adenylyltransferase 1, nicotinamide mononucleotide adenylyltransferase 1, nicotinamide nucleotide adenylyltransferase, nicotinamide nucleotide adenylyltransferase 1, Nicotinate-nucleotide adenylyltransferase 1, NMN adenylyltransferase 1, NMNATPNAT1, pyridine nucleotide adenylyltransferase 1 |
| Gene, Accession # | NMNAT1, Gene ID: 64802 |
| Catalog # | NBP2-32464 |
| Price | |
| Order / More Info | NMNAT-1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|