| Edit |   |
| Antigenic Specificity | TCTEX1D4 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TCTEX1D4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TCTEX1D4. This antibody reacts with human. The TCTEX1D4 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to RP11-269F19.9 The peptide sequence was selected from the N terminal of RP11-269F19.9. Peptide sequence RGSMLGLAASFSRRNSLVGPGAGPGGQRPSLGPVPPLGSRVSFSGLPLAP. |
| Other Names | Tctex1 domain containing 4 |
| Gene, Accession # | TCTEX1D4, Gene ID: 343521 |
| Catalog # | NBP1-70720-20ul |
| Price | |
| Order / More Info | TCTEX1D4 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |