| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | DNLZ |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DNLZ Antibody from Novus Biologicals is a rabbit polyclonal antibody to DNLZ. This antibody reacts with human. The DNLZ Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human DNLZ antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LGWFSDLNGKRNIEEILTARGEQVHRVAGEGALELVLEAAGAPTSTAAPEAGE |
|---|
| Other Names | BA413M3.2, C9orf151, Chromosome 9 Open Reading Frame 151, DNL-Type Zinc Finger, DNL-Type Zinc Finger Protein, HEP1, Homolog (Yeast), HSP70 Escort Protein, Hsp70-Escort Protein 1, MtHsp70-Escort Protein, TIMM15, Translocase Of Inner Mitochondrial Membrane 15, ZIM17 |
|---|
| Gene, Accession # | DNLZ, Gene ID: 728489 |
|---|
| Catalog # | NBP2-57694 |
|---|
| Price | |
|---|
| Order / More Info | DNLZ Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|