| 产品详情 |
| Edit |   |
| Antigenic Specificity | MARK4 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The MARK4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MARK4. This antibody reacts with human. The MARK4 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human MARK4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PSDTTNGTSSSKGTSHSKGQRSSSSTYHRQRRHSDFCGPSPAPLHPKRSPTSTGEAELKEERLPGRKASCSTAGSGSR |
| Other Names | EC 2.7.11, EC 2.7.11.1, FLJ12177, FLJ90097, KIAA1860MARK4L, MAP/microtubule affinity-regulating kinase 4, MAP/microtubule affinity-regulating kinase like 1, MAP/microtubule affinity-regulating kinase-like 1, MARK4 serine/threonine protein kinase, MARKL1L, MARKL1MARK4S, Nbla00650 |
| Gene, Accession # | MARK4, Gene ID: 57787 |
| Catalog # | NBP1-83442 |
| Price | |
| Order / More Info | MARK4 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|