| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Mark3 |
|---|
| Clone | 1A10 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2b kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Mark3 Antibody (1A10) from Novus Biologicals is a mouse monoclonal antibody to Mark3. This antibody reacts with human. The Mark3 Antibody (1A10) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | MARK3 (NP_002367.4 402 a.a. - 500 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HHKVQRSVFSSQKQRRYSDHAGPAIPSVVAYPKRSQTSTADSDLKEDGISSRKSSGSAVGGKGIAPASPMLGNASNPNKADIPERKKSSTVPSSNTASG |
|---|
| Other Names | Cdc25C-associated protein kinase 1, cTAK1, C-TAK1, CTAK1ELKL motif kinase 2, EC 2.7.11, EC 2.7.11.1, EMK2, EMK-2, KP78, MAP/microtubule affinity-regulating kinase 3, PAR1A, Protein kinase STK10, Ser/Thr protein kinase PAR-1, Serine/threonine-protein kinase p78 |
|---|
| Gene, Accession # | MARK3, Gene ID: 4140, Accession: NP_002367, SwissProt: NP_002367 |
|---|
| Catalog # | H00004140-M01 |
|---|
| Price | |
|---|
| Order / More Info | Mark3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|