| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MARK2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MARK2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MARK2. This antibody reacts with human. The MARK2 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human MARK2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: EDRESGRKASSTAKVPASPLPGLERKKTTPTPSTNSVLSTSTNRSRNSPLLERASLGQASIQNGKDSLTMPGSRASTASASAAVSAARPRQHQKSMS |
|---|
| Other Names | EC 2.7.11, EC 2.7.11.1, ELKL motif kinase, ELKL motif kinase 1, EMK-1, EMK1PAR-1, MAP/microtubule affinity-regulating kinase 2MGC99619, PAR1 homolog, Par1b, Ser/Thr protein kinase PAR-1B, serine/threonine protein kinase EMK, serine/threonine-protein kinase MARK2 |
|---|
| Gene, Accession # | MARK2, Gene ID: 2011 |
|---|
| Catalog # | NBP2-57851 |
|---|
| Price | |
|---|
| Order / More Info | MARK2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|