| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Beta-endorphin |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | rat |
|---|
| Isotype | n/a |
|---|
| Format | unpurified |
|---|
| Size | 0.05 ml |
|---|
| Concentration | lyophilized |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For slide-mounted tissue sections it is recommended to make working dilution for immunofluorescence histochemistry 15 ug/ml, whereas for avidin-biotin immunohistochemistry antiserum may be diluted to 5 ug/ml. Optimal dilutions/concentrations should be determined by the end user. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Beta-endorphin Antibody from Novus Biologicals is a rabbit polyclonal antibody to Beta-endorphin. This antibody reacts with rat. The Beta-endorphin Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity: Cross reactivity: beta-endorphin (100%), Met-enkephalin (0 |
|---|
| Immunogen | Antiserum to beta Endorphin was raised in rabbits by using the N-terminal portion of bovine beta Endorphin conjugated to thyroglobulin. (YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE) |
|---|
| Other Names | ACTH, adrenocorticotropic hormone, adrenocorticotropin, alpha-melanocyte-stimulating hormone, alpha-MSH, beta-endorphin, beta-LPH, beta-melanocyte-stimulating hormone, beta-MSH, CLIP, corticotropin-like intermediary peptide, corticotropin-lipotropin, gamma-LPH, gamma-MSH, lipotropin beta, lipotropin gamma, LPH, melanotropin alpha, melanotropin beta, melanotropin gamma, met-enkephalin, MSH, NPP, POC, pro-ACTH-endorphin, proopiomelanocortin, pro-opiomelanocortin, proopiomelanocortin preproprotein |
|---|
| Gene, Accession # | POMC, Gene ID: 5443, Accession: P01194 |
|---|
| Catalog # | NB120-10339 |
|---|
| Price | |
|---|
| Order / More Info | Beta-endorphin Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|