| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PCBD2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PCBD2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PCBD2. This antibody reacts with human. The PCBD2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to the N terminal of PCBD2. Immunizing peptide sequence SGTHRLTAEERNQAILDLKAAGWSELSERDAIYKEFSFHNFNQAFGFMSR. |
|---|
| Other Names | 4-alpha-hydroxy-tetrahydropterin dehydratase 2, DCOH2DCOHMPHS2,6-pyruvoyl-tetrahydropterin synthase/dimerization cofactor of hepatocytenuclear factor 1 alpha (TCF1) 2, DcoH-like protein DCoHm, dimerization cofactor of hepatocyte nuclear factor 1 (HNF1) from muscle, dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1), Dimerization cofactor of hepatocyte nuclear factor 1 from muscle, EC 4.2.1.96, HNF-1-alpha dimerization cofactor, PHS 2, pterin-4 alpha-carbinolamine dehydratase 2, pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocytenuclear factor 1 alpha (TCF1) 2, pterin-4-alpha-carbinolamine dehydratase 2 |
|---|
| Gene, Accession # | PCBD2, Gene ID: 84105, Accession: Q9H0N5, SwissProt: Q9H0N5 |
|---|
| Catalog # | NBP1-74264 |
|---|
| Price | |
|---|
| Order / More Info | PCBD2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|