| 产品详情 |
| Edit |   |
| Antigenic Specificity | PCBD1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PCBD1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PCBD1. This antibody reacts with human. The PCBD1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human PCBD1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MAGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTR |
| Other Names | 4-alpha-hydroxy-tetrahydropterin dehydratase, DCoH, DCOHpterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocytenuclear factor 1 alpha (TCF1), Dimerization cofactor of hepatocyte nuclear factor 1-alpha, Dimerization cofactor of HNF1, PCBDdimerizing cofactor for HNF1,6-pyruvoyl-tetrahydropterin synthase/dimerization cofactor of hepatocytenuclear factor 1 alpha (TCF1), PCDEC 4.2.1.96, Phenylalanine hydroxylase-stimulating protein, PHS, Pterin carbinolamine dehydratase, pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocytenuclear factor 1 alpha, pterin-4-alpha-carbinolamine dehydratase |
| Gene, Accession # | PCBD1, Gene ID: 5092 |
| Catalog # | NBP1-84297 |
| Price | |
| Order / More Info | PCBD1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|