| Edit |   |
| Antigenic Specificity | SH3BGRL |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SH3BGRL Antibody from Novus Biologicals is a rabbit polyclonal antibody to SH3BGRL. This antibody reacts with human. The SH3BGRL Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence. |
| Immunogen | Synthetic peptides corresponding to SH3BGRL(SH3 domain binding glutamic acid-rich protein like) The peptide sequence was selected from the middle region of SH3BGRL. Peptide sequence PQIFNESQYRGDYDAFFEARENNAVYAFLGLTAPPGSKEAEVQAKQQA. |
| Other Names | MGC117402, SH3 domain binding glutamic acid-rich protein like, SH3 domain-binding glutamic acid-rich-like protein, SH3BGR, SH3-binding domain glutamic acid-rich protein like |
| Gene, Accession # | SH3BGRL, Gene ID: 6451, Accession: O75368, SwissProt: O75368 |
| Catalog # | NBP1-57643 |
| Price | |
| Order / More Info | SH3BGRL Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |