| Edit |   |
| Antigenic Specificity | SH3BGR |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SH3BGR Antibody from Novus Biologicals is a rabbit polyclonal antibody to SH3BGR. This antibody reacts with human. The SH3BGR Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the N terminal of human SH3BGR. Peptide sequence CGDFDSFFSAKEENIIYSFLGLAPPPDSKGSEKAEEGGETEAQKEGSEDV. |
| Other Names | 21-GARP21-glutamic acid-rich protein, 21-Glutamic Acid-Rich Protein (21-GARP)10SH3-binding domain and glutamic acid-rich protein, SH3 domain binding glutamic acid-rich protein, SH3 domain-binding glutamic acid-rich protein, SH3BGR protein, SH3GBR |
| Gene, Accession # | SH3BGR, Gene ID: 6450, Accession: NP_031367, SwissProt: NP_031367 |
| Catalog # | NBP1-80550-20ul |
| Price | |
| Order / More Info | SH3BGR Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |