| Edit |   |
|---|
| Antigenic Specificity | SH3BGR |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SH3BGR Antibody from Novus Biologicals is a rabbit polyclonal antibody to SH3BGR. This antibody reacts with human. The SH3BGR Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human SH3BGR antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MPLLLLGETEPLKLERDCRSPVDPWAAASPDLALACLCHCQDLSSGAFPDRGVL |
|---|
| Other Names | 21-GARP21-glutamic acid-rich protein, 21-Glutamic Acid-Rich Protein (21-GARP)10SH3-binding domain and glutamic acid-rich protein, SH3 domain binding glutamic acid-rich protein, SH3 domain-binding glutamic acid-rich protein, SH3BGR protein, SH3GBR |
|---|
| Gene, Accession # | SH3BGR, Gene ID: 6450, Accession: P55822, SwissProt: P55822 |
|---|
| Catalog # | NBP2-38161 |
|---|
| Price | |
|---|
| Order / More Info | SH3BGR Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|