| Edit |   |
|---|
| Antigenic Specificity | GRSF1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GRSF1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GRSF1. This antibody reacts with human. The GRSF1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to GRSF1(G-rich RNA sequence binding factor 1) The peptide sequence was selected from the middle region of GRSF1 (NP_002083). Peptide sequence IRNGENGIHFLLNRDGKRRGDALIEMESEQDVQKALEKHRMYMGQRYVEV. |
|---|
| Other Names | FLJ13125, G-rich RNA sequence binding factor 1, G-rich sequence factor 1, GRSF-1 |
|---|
| Gene, Accession # | GRSF1, Gene ID: 2926, Accession: Q12849, SwissProt: Q12849 |
|---|
| Catalog # | NBP1-57316 |
|---|
| Price | |
|---|
| Order / More Info | GRSF1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 23025254 |
|---|