| Edit |   |
|---|
| Antigenic Specificity | EVA1/MPZL2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The EVA1/MPZL2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to EVA1/MPZL2. This antibody reacts with human, mouse. The EVA1/MPZL2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to MPZL2(myelin protein zero-like 2) The peptide sequence was selected from the N terminal of MPZL2. Peptide sequence LEAVNGTDARLKCTFSSFAPVGDALTVTWNFRPLDGGPEQFVFYYHIDPF. |
|---|
| Other Names | EVAEpithelial V-like antigen 1EVA1myelin protein zero-like protein 2, myelin protein zero-like 2 |
|---|
| Gene, Accession # | MPZL2, Gene ID: 10205, Accession: O70255 |
|---|
| Catalog # | NBP1-59230 |
|---|
| Price | |
|---|
| Order / More Info | EVA1/MPZL2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|