| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Biliverdin Reductase B/BLVRB |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Biliverdin Reductase B/BLVRB Antibody from Novus Biologicals is a rabbit polyclonal antibody to Biliverdin Reductase B/BLVRB. This antibody reacts with human. The Biliverdin Reductase B/BLVRB Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to BLVRB(biliverdin reductase B (flavin reductase (NADPH))) The peptide sequence was selected from the middle region of BLVRB. Peptide sequence GLKYVAVMPPHIGDQPLTGAYTVTLDGRGPSRVISKHDLGHFMLRCLTTD. |
|---|
| Other Names | Biliverdin reductase B, biliverdin reductase B (flavin reductase (NADPH)), Biliverdin-IX beta-reductase, BVR-B, EC 1.3.1.24, EC 1.5.1.30, flavin reductase, flavin reductase (NADPH), FLRBVRB, FR, GHBP, Green heme-binding protein, MGC117413, NADPH-dependent diaphorase, NADPH-flavin reductase, SDR43U1, short chain dehydrogenase/reductase family 43U, member 1 |
|---|
| Gene, Accession # | BLVRB, Gene ID: 645, Accession: P30043, SwissProt: P30043 |
|---|
| Catalog # | NBP1-53068 |
|---|
| Price | |
|---|
| Order / More Info | Biliverdin Reductase B/BLVRB Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|