| Edit |   |
|---|
| Antigenic Specificity | SHB |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SHB Antibody from Novus Biologicals is a rabbit polyclonal antibody to SHB. This antibody reacts with human. The SHB Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to SHB(Src homology 2 domain containing adaptor protein B) The peptide sequence was selected from the N terminal of SHB. Peptide sequence ERPSQPPQAVPQASSAASASCGPATASCFSASSGSLPDDSGSTSDLIRAY. |
|---|
| Other Names | bA3J10.2, RP11-3J10.8, SH2 domain-containing adapter protein B, SHB (Src homology 2 domain containing) adaptor protein B, SHB adaptor protein (a Src homology 2 protein), Src homology 2 domain containing adaptor protein B |
|---|
| Gene, Accession # | SHB, Gene ID: 6461, Accession: Q15464, SwissProt: Q15464 |
|---|
| Catalog # | NBP1-58355 |
|---|
| Price | |
|---|
| Order / More Info | SHB Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|