| Edit |   |
| Antigenic Specificity | SHB |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SHB Antibody from Novus Biologicals is a rabbit polyclonal antibody to SHB. This antibody reacts with human. The SHB Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to SHB(Src homology 2 domain containing adaptor protein B) The peptide sequence was selected from the N terminal of SHB. Peptide sequence ERPSQPPQAVPQASSAASASCGPATASCFSASSGSLPDDSGSTSDLIRAY. |
| Other Names | bA3J10.2, RP11-3J10.8, SH2 domain-containing adapter protein B, SHB (Src homology 2 domain containing) adaptor protein B, SHB adaptor protein (a Src homology 2 protein), Src homology 2 domain containing adaptor protein B |
| Gene, Accession # | SHB, Gene ID: 6461, Accession: Q15464, SwissProt: Q15464 |
| Catalog # | NBP1-58355-20ul |
| Price | |
| Order / More Info | SHB Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |