| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SH2B2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SH2B2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SH2B2. This antibody reacts with human. The SH2B2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human SH2B2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RDKWTRRLRLSRTLAAKVELVDIQREGALRFMVADD |
|---|
| Other Names | adaptor protein with pleckstrin homology and src homology 2 domains, APSAdapter protein with pleckstrin homology and Src homology 2 domains, SH2 and PH domain-containing adapter protein APS, SH2B adapter protein 2, SH2B adaptor protein 2 |
|---|
| Gene, Accession # | SH2B2, Gene ID: 10603 |
|---|
| Catalog # | NBP2-13305 |
|---|
| Price | |
|---|
| Order / More Info | SH2B2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|