| Edit |   |
|---|
| Antigenic Specificity | FBXO3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FBXO3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to FBXO3. This antibody reacts with human. The FBXO3 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to FBXO3(F-box protein 3) The peptide sequence was selected from the N terminal of FBXO3. Peptide sequence NCCYVSRRLSQLSSHDPLWRRHCKKYWLISEEEKTQKNQCWKSLFIDTYS. |
|---|
| Other Names | DKFZp564B092, F-box protein 3, F-box protein FBX3, FBX3FBAF-box only protein 3 |
|---|
| Gene, Accession # | FBXO3, Gene ID: 26273, Accession: Q9UK99, SwissProt: Q9UK99 |
|---|
| Catalog # | NBP1-55046 |
|---|
| Price | |
|---|
| Order / More Info | FBXO3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|