| Edit |   |
| Antigenic Specificity | FBXO3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified, no preservative |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The FBXO3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to FBXO3. This antibody reacts with human. The FBXO3 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to FBXO3(F-box protein 3) The peptide sequence was selected from the N terminal of FBXO3. Peptide sequence NCCYVSRRLSQLSSHDPLWRRHCKKYWLISEEEKTQKNQCWKSLFIDTYS. |
| Other Names | DKFZp564B092, F-box protein 3, F-box protein FBX3, FBX3FBAF-box only protein 3 |
| Gene, Accession # | FBXO3, Gene ID: 26273, Accession: Q9UK99, SwissProt: Q9UK99 |
| Catalog # | NBP1-55046-20ul |
| Price | |
| Order / More Info | FBXO3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |