| Edit |   |
|---|
| Antigenic Specificity | FBXO28 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FBXO28 Antibody from Novus Biologicals is a rabbit polyclonal antibody to FBXO28. This antibody reacts with human. The FBXO28 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to FBXO28(F-box protein 28) The peptide sequence was selected from the middle region of FBXO28. Peptide sequence ELERKLREVMESAVGNSSGSGQNEESPRKRKKATEAIDSLRKSKRLRNRK. |
|---|
| Other Names | F-box only protein 28, F-box protein 28, FBX28, KIAA0483FLJ10766 |
|---|
| Gene, Accession # | FBXO28, Gene ID: 23219, Accession: Q9NVF7, SwissProt: Q9NVF7 |
|---|
| Catalog # | NBP1-55341-20ul |
|---|
| Price | |
|---|
| Order / More Info | FBXO28 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|