| Edit |   |
| Antigenic Specificity | FBXO24 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified, no preservative |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The FBXO24 Antibody from Novus Biologicals is a rabbit polyclonal antibody to FBXO24. This antibody reacts with human. The FBXO24 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to FBXO24(F-box protein 24) The peptide sequence was selected from the N terminal of FBXO24. Peptide sequence VCDGEGVWRRICRRLSPRLQDQDTKGLYFQAFGGRRRCLSKSVAPLLAHG. |
| Other Names | DKFZp434I1122, F-box protein 24, F-box protein Fbx24, FBX24F-box only protein 24 |
| Gene, Accession # | FBXO24, Gene ID: 26261, Accession: O75426, SwissProt: O75426 |
| Catalog # | NBP1-53140 |
| Price | |
| Order / More Info | FBXO24 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |