| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | XCL1/Lymphotactin |
|---|
| Clone | 1E1 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunohistochemistry-Paraffin. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The XCL1/Lymphotactin Antibody (1E1) from Novus Biologicals is a mouse monoclonal antibody to XCL1/Lymphotactin. This antibody reacts with human. The XCL1/Lymphotactin Antibody (1E1) has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | XCL1 (NP_002986, 22 a.a. - 114 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VGSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG |
|---|
| Other Names | ATACSmall-inducible cytokine C1, C motif chemokine 1, chemokine (C motif) ligand 1, Cytokine SCM-1, LPTNSCM-1-alpha, LTNXC chemokine ligand 1, lymphotactin, lymphotaxin, SCM-1, SCM-1a, SCM1A, SCYC1SCM1, single cysteine motif 1a, small inducible cytokine subfamily C, member 1 (lymphotactin) |
|---|
| Gene, Accession # | XCL1, Gene ID: 6375, Accession: NP_002986, SwissProt: NP_002986 |
|---|
| Catalog # | H00006375-M01 |
|---|
| Price | |
|---|
| Order / More Info | XCL1/Lymphotactin Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|