| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | XCL1/Lymphotactin |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The XCL1/Lymphotactin Antibody from Novus Biologicals is a rabbit polyclonal antibody to XCL1/Lymphotactin. This antibody reacts with human. The XCL1/Lymphotactin Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human XCL1/Lymphotactin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG |
|---|
| Other Names | ATACSmall-inducible cytokine C1, C motif chemokine 1, chemokine (C motif) ligand 1, Cytokine SCM-1, LPTNSCM-1-alpha, LTNXC chemokine ligand 1, lymphotactin, lymphotaxin, SCM-1, SCM-1a, SCM1A, SCYC1SCM1, single cysteine motif 1a, small inducible cytokine subfamily C, member 1 (lymphotactin) |
|---|
| Gene, Accession # | XCL1, Gene ID: 6375, Accession: Q9UBD3 |
|---|
| Catalog # | NBP2-46844 |
|---|
| Price | |
|---|
| Order / More Info | XCL1/Lymphotactin Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|