| Edit |   |
|---|
| Antigenic Specificity | CPEB3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CPEB3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CPEB3. This antibody reacts with human. The CPEB3 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to CPEB3(cytoplasmic polyadenylation element binding protein 3) The peptide sequence was selected from the middle region of CPEB3 (NP_055727). Peptide sequence RTDNGNNLLPFQDRSRPYDTFNLHSLENSLMDMIRTDHEPLKGKHYPPSG. |
|---|
| Other Names | CPE-binding protein 3, cytoplasmic polyadenylation element binding protein 3, cytoplasmic polyadenylation element-binding protein 3, hCPEB-3, KIAA0940CPE-BP3 |
|---|
| Gene, Accession # | CPEB3, Gene ID: 22849, Accession: Q8NE35, SwissProt: Q8NE35 |
|---|
| Catalog # | NBP1-56919 |
|---|
| Price | |
|---|
| Order / More Info | CPEB3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|