| Edit |   |
|---|
| Antigenic Specificity | CPA6 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CPA6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CPA6. This antibody reacts with human. The CPA6 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the middle region of human CPA6The immunogen for this antibody is CPA6. Peptide sequence QSVYGVRYRYGPASTTLYVSSGSSMDWAYKNGIPYAFAFELRDTGYFGFL. |
|---|
| Other Names | carboxypeptidase A6, CPAHCarboxypeptidase B, EC 3.4.17, EC 3.4.17.1 |
|---|
| Gene, Accession # | CPA6, Gene ID: 57094, Accession: NP_065094, SwissProt: NP_065094 |
|---|
| Catalog # | NBP1-79670-20ul |
|---|
| Price | |
|---|
| Order / More Info | CPA6 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|