| Edit |   |
| Antigenic Specificity | TPRKB |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TPRKB Antibody from Novus Biologicals is a rabbit polyclonal antibody to TPRKB. This antibody reacts with human. The TPRKB Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to TPRKB(TP53RK binding protein) The peptide sequence was selected from the middle region of TPRKB. Peptide sequence EGTIDGSLINPTVIVDPFQILVAANKAVHLYKLGKMKTRTLSTEIIFNLS. |
| Other Names | CGI-121, PRPK (p53-related protein kinase)-binding protein, PRPK-binding protein, TP53RK binding protein, TP53RK-binding protein |
| Gene, Accession # | TPRKB, Gene ID: 51002, Accession: Q9Y3C4, SwissProt: Q9Y3C4 |
| Catalog # | NBP1-56860 |
| Price | |
| Order / More Info | TPRKB Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |