| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Slug |
|---|
| Clone | 3C12 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | IgG3 kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. Antibody reactivity against cell lysate, tissue lysate and recombinant protein for WB. It has been used for IF and ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Slug Antibody (3C12) from Novus Biologicals is a mouse monoclonal antibody to Slug. This antibody reacts with human, mouse, rat. The Slug Antibody (3C12) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. |
|---|
| Immunogen | SNAI2 (NP_003059, 97 a.a. - 169 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KDHSGSESPISDEEERLQSKLSDPHAIEAEKFQCNLCNKTYSTFSGLAKHKQLHCDAQSRKSFSCKYCDKEYV |
|---|
| Other Names | MGC10182, Neural crest transcription factor Slug, Protein snail homolog 2, slug homolog, zinc finger protein (chicken), SLUGH, SLUGzinc finger protein, snail 2, snail homolog 2 (Drosophila), WS2D, zinc finger protein SNAI2 |
|---|
| Gene, Accession # | SNAI2, Gene ID: 6591, Accession: NP_003059, SwissProt: NP_003059 |
|---|
| Catalog # | H00006591-M05 |
|---|
| Price | |
|---|
| Order / More Info | Slug Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|