| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SNTB2 |
|---|
| Clone | 3F12 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | Protein A purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | ELISA. This antibody is reactive against recombinant protein in ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SNTB2 Antibody (3F12) from Novus Biologicals is a mouse monoclonal antibody to SNTB2. This antibody reacts with human. The SNTB2 Antibody (3F12) has been validated for the following applications: ELISA. |
|---|
| Immunogen | SNTB2 (NP_006741.1 116 a.a. - 210 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VRVVKQEAGGLGISIKGGRENRMPILISKIFPGLAADQSRALRLGDAILSVNGTDLRQATHDQAVQALKRAGKEVLLEVKFIREVTPYIKKPSLV |
|---|
| Other Names | D16S2531E, EST25263, SNT2B2dystrophin-associated protein A1, 59kD, basic component 2, SNT3beta-2-syntrophin, SNTLsyntrophin-3, syntrophin, beta 2 (dystrophin-associated protein A1, 59kD, basic component 2), syntrophin, beta 2 (dystrophin-associated protein A1, 59kDa, basic component 2), Syntrophin-3,59 kDa dystrophin-associated protein A1 basic component 2, Syntrophin-like |
|---|
| Gene, Accession # | SNTB2, Gene ID: 6645, Accession: NP_006741, SwissProt: NP_006741 |
|---|
| Catalog # | H00006645-M01 |
|---|
| Price | |
|---|
| Order / More Info | SNTB2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|