| Edit |   |
| Antigenic Specificity | SNRPD2P2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SNRPD2P2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SNRPD2P2. This antibody reacts with human. The SNRPD2P2 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to LOC645339 (hypothetical LOC645339) The peptide sequence was selected from the middle region of LOC645339. Peptide sequence MVLENVKEMCTEVPKGGNGGKGKKKSKPANKDHFISKLFLCRDSVITNKW. |
| Other Names | SNRPD2P2 small nuclear ribonucleoprotein D2 pseudogene 2 |
| Gene, Accession # | LOC645339, Gene ID: 645339 |
| Catalog # | NBP1-70708 |
| Price | |
| Order / More Info | SNRPD2P2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |