| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PDK-1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. WB reported in the literature (PMID: 30092282). |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PDK-1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PDK-1. This antibody reacts with human. The PDK-1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human PDK-1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KEISLLPDNLLRTPSVQLVQSWYIQSLQELLDFKDKSAEDAKAIYDFTDTVIRIRNRHND |
|---|
| Other Names | [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 1, mitochondrial, EC 2.7.11, EC 2.7.11.2, mitochondrial pyruvate dehydrogenase, lipoamide, kinase isoenzyme 1, Pyruvate dehydrogenase kinase isoform 1, pyruvate dehydrogenase kinase, isoenzyme 1, pyruvate dehydrogenase kinase, isozyme 1 |
|---|
| Gene, Accession # | PDK1, Gene ID: 5163, Accession: Q15118, SwissProt: Q15118 |
|---|
| Catalog # | NBP1-85955 |
|---|
| Price | |
|---|
| Order / More Info | PDK-1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 25322816, 30092282 |
|---|
| 产品资料 |
|
|