| 产品详情 |
| Edit |   |
| Antigenic Specificity | PDIA6 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PDIA6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PDIA6. This antibody reacts with human, mouse. The PDIA6 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation. |
| Immunogen | Synthetic peptides corresponding to PDIA6(protein disulfide isomerase family A, member 6) The peptide sequence was selected from the N terminal of PDIA6. Peptide sequence KNRPEDYQGGRTGEAIVDAALSALRQLVKDRLGGRSGGYSSGKQGRSDSS. |
| Other Names | EC 5.3.4.1, Endoplasmic reticulum protein 5, ERp5, ERP5ER protein 5, P5TXNDC7, protein disulfide isomerase family A, member 6, Protein disulfide isomerase P5, protein disulfide isomerase-associated 6, protein disulfide isomerase-related protein, protein disulfide-isomerase A6, thioredoxin domain containing 7 (protein disulfide isomerase), Thioredoxin domain-containing protein 7 |
| Gene, Accession # | PDIA6, Gene ID: 10130, Accession: Q15084, SwissProt: Q15084 |
| Catalog # | NBP1-57999-20ul |
| Price | |
| Order / More Info | PDIA6 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|