| 产品详情 |
| Edit |   |
| Antigenic Specificity | PDIA6 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PDIA6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PDIA6. This antibody reacts with human. The PDIA6 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated. Specificity of human PDIA6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: YGIRGFPTIKIFQKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELLEIINEDIAKRTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKLA |
| Other Names | EC 5.3.4.1, Endoplasmic reticulum protein 5, ERp5, ERP5ER protein 5, P5TXNDC7, protein disulfide isomerase family A, member 6, Protein disulfide isomerase P5, protein disulfide isomerase-associated 6, protein disulfide isomerase-related protein, protein disulfide-isomerase A6, thioredoxin domain containing 7 (protein disulfide isomerase), Thioredoxin domain-containing protein 7 |
| Gene, Accession # | PDIA6, Gene ID: 10130, Accession: Q15084, SwissProt: Q15084 |
| Catalog # | NBP2-38213 |
| Price | |
| Order / More Info | PDIA6 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|