| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PDI |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PDI Antibody from Novus Biologicals is a rabbit polyclonal antibody to PDI. This antibody reacts with human. The PDI Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human PDI antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LIGGRDLVVIGFFQDLQDEDVATFLALAQDALDMTFGLTDRPRLFQQFGLTKDTV |
|---|
| Other Names | Pancreas-specific protein disulfide isomerase, pancreatic protein disulfide isomerase, PDA2, PDI, PDIp, PDIPEC 5.3.4.1, PDIR, protein disulfide isomerase A2, protein disulfide isomerase family A, member 2, protein disulfide isomerase, pancreatic, protein disulfide isomerase-associated 2, protein disulfide-isomerase A2, Rho GDP dissociation inhibitor gamma |
|---|
| Gene, Accession # | PDIA2, Gene ID: 64714 |
|---|
| Catalog # | NBP2-49086 |
|---|
| Price | |
|---|
| Order / More Info | PDI Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|