| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | HAX-1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The HAX-1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to HAX-1. This antibody reacts with human. The HAX-1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human HAX-1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: HQPRIFGGVLESDARSESPQPAPDWGSQRPFHRFDDVWPMDPHPRTREDNDLDSQVSQEGL |
|---|
| Other Names | FLJ17042, FLJ93803, HAX-1, HCLS1 (and PKD2) associated protein, HCLS1 associated protein X-1, HCLS1-associated protein X-1, HCLSBP1, HS1 binding protein, HS1-associating protein X-1, HS1-binding protein 1, HS1BP1FLJ18492, HSP1BP-1, SCN3 |
|---|
| Gene, Accession # | HAX1, Gene ID: 10456 |
|---|
| Catalog # | NBP2-49169 |
|---|
| Price | |
|---|
| Order / More Info | HAX-1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|