| Edit |   |
| Antigenic Specificity | SLFN14 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SLFN14 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SLFN14. This antibody reacts with human. The SLFN14 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human SLFN14 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: DPFQIHHADVNGLPPPSAQFPRKTITSGIHCALEIAKVMKEEMKRIKENPPSNMSPDTLALFSETAYEEATCAQALPGVCETKTNLTTEQIANYVGRK |
| Other Names | schlafen family member 14 |
| Gene, Accession # | SLFN14, Gene ID: 342618, Accession: P0C7P3, SwissProt: P0C7P3 |
| Catalog # | NBP2-33896 |
| Price | |
| Order / More Info | SLFN14 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |