| Edit |   |
| Antigenic Specificity | SLFN12 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SLFN12 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SLFN12. This antibody reacts with human. The SLFN12 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to SLFN12(schlafen family member 12) The peptide sequence was selected from the middle region of SLFN12. Peptide sequence KYLLKALFKALKRLKSLRDQFSFAENLYQIIGIDCFQKNDKKMFKSCRRL. |
| Other Names | schlafen family member 12 |
| Gene, Accession # | SLFN12, Gene ID: 55106 |
| Catalog # | NBP1-70707 |
| Price | |
| Order / More Info | SLFN12 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |