| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SLCO5A1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. WB reported in scientific literature (PMID: 26415544). For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SLCO5A1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SLCO5A1. This antibody reacts with human. The SLCO5A1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human SLCO5A1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SVDAVSDDDVLKEKSNNSEQADKKVSSMGFGKDVRDLPRAAVRILSNM |
|---|
| Other Names | FLJ39560, member 15, OATP5A1, OATPRP4, organic anion transporter polypeptide-related protein 4, SLC21A15, solute carrier organic anion transporter family, member 5A1 |
|---|
| Gene, Accession # | SLCO5A1, Gene ID: 81796, Accession: Q9H2Y9, SwissProt: Q9H2Y9 |
|---|
| Catalog # | NBP1-82498 |
|---|
| Price | |
|---|
| Order / More Info | SLCO5A1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 24179389, 26415544 |
|---|
| 产品资料 |
|
|