| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SLCO4A1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SLCO4A1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SLCO4A1. This antibody reacts with human. The SLCO4A1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human SLCO4A1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GYPRQLPGSQRYAVMRAAEMHQLKDSSRGEASNPDFGKTIRDLPL |
|---|
| Other Names | colon organic anion transporter, OATP1, OATP4A1, OATPE, OATP-E, OATP-RP1, organic anion-transporting polypeptide E, POAT, SLC21A12, solute carrier family 21 (organic anion transporter), member 12, solute carrier family 21 member 12, solute carrier organic anion transporter family member 4A1, solute carrier organic anion transporter family, member 4A1 |
|---|
| Gene, Accession # | SLCO4A1, Gene ID: 28231 |
|---|
| Catalog # | NBP1-80978 |
|---|
| Price | |
|---|
| Order / More Info | SLCO4A1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|