| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SLCO3A1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SLCO3A1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SLCO3A1. This antibody reacts with human. The SLCO3A1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to SLCO3A1(solute carrier organic anion transporter family, member 3A1) The peptide sequence was selected from the middle region of SLCO3A1 (NP_037404). Peptide sequence MEIAVVAGFAAFLGKYLEQQFNLTTSSANQLLGMTAIPCACLGIFLGG |
|---|
| Other Names | FLJ40478, OATP3A1OATP-RP3, OATP-DOATPRP3, OATPDSLC21A11, Organic anion transporter polypeptide-related protein 3, Organic anion-transporting polypeptide D, PGE1 transporter, Sodium-independent organic anion transporter D, solute carrier family 21 (organic anion transporter), member 11, Solute carrier family 21 member 11, solute carrier organic anion transporter family member 3A1, solute carrier organic anion transporter family, member 3A1 |
|---|
| Gene, Accession # | SLCO3A1, Gene ID: 28232, Accession: Q9UIG8, SwissProt: Q9UIG8 |
|---|
| Catalog # | NBP1-59678 |
|---|
| Price | |
|---|
| Order / More Info | SLCO3A1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|