| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SLCO3A1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. Recommended conditions for IHC,Retrieval method: HIER pH6 |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SLCO3A1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SLCO3A1. This antibody reacts with human. The SLCO3A1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LPEFLTHQYKYEAGEIRWGAEGRDVCAANGSGGDEGPDPDLICRNRTATNM |
|---|
| Other Names | FLJ40478, OATP3A1OATP-RP3, OATP-DOATPRP3, OATPDSLC21A11, Organic anion transporter polypeptide-related protein 3, Organic anion-transporting polypeptide D, PGE1 transporter, Sodium-independent organic anion transporter D, solute carrier family 21 (organic anion transporter), member 11, Solute carrier family 21 member 11, solute carrier organic anion transporter family member 3A1, solute carrier organic anion transporter family, member 3A1 |
|---|
| Gene, Accession # | SLCO3A1, Gene ID: 28232 |
|---|
| Catalog # | NBP2-68838 |
|---|
| Price | |
|---|
| Order / More Info | SLCO3A1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|