| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SLCO2A1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. WB reactivity reported in (PMID:26415544). ICC/IF and IHC reactivity reported in (PMID: 26539716). |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SLCO2A1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SLCO2A1. This antibody reacts with human. The SLCO2A1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human SLCO2A1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PSTSSSIHPQSPACRRDCSCPDSIFHPVCGDNGIEYLSPCHAGCSNINMS SATSKQLIYLNCSCVTGGSASAKTGSCPVPCAH |
|---|
| Other Names | OATP2A1member 2, PGTmatrin F/G 1, Prostaglandin transporter, Solute carrier family 21 member 2, solute carrier organic anion transporter family member 2A1, solute carrier organic anion transporter family, member 2A1 |
|---|
| Gene, Accession # | SLCO2A1, Gene ID: 6578 |
|---|
| Catalog # | NBP2-13349 |
|---|
| Price | |
|---|
| Order / More Info | SLCO2A1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 26415544, 26539716 |
|---|
| 产品资料 |
|
|