| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | UbcH5b/UBE2D2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The UbcH5b/UBE2D2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to UbcH5b/UBE2D2. This antibody reacts with human. The UbcH5b/UBE2D2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to UBE2D2(ubiquitin-conjugating enzyme E2D 2 (UBC4/5 homolog, yeast)) The peptide sequence was selected from the N terminal of UBE2D2. Peptide sequence ALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFF. |
|---|
| Other Names | E2(17)KB2, EC 6.3.2.19, PUBC1, UBC4/5, UBC4ubiquitin-conjugating enzyme E2D 2 (homologous to yeast UBC4/5), UBC5B, UBCH4, UbcH5B, Ubiquitin carrier protein D2, ubiquitin-conjugating enzyme E2 D2, Ubiquitin-conjugating enzyme E2(17)KB 2, Ubiquitin-conjugating enzyme E2-17 kDa 2, ubiquitin-conjugating enzyme E2D 2 (UBC4/5 homolog, yeast), Ubiquitin-protein ligase D2 |
|---|
| Gene, Accession # | UBE2D2, Gene ID: 7322, Accession: P62837, SwissProt: P62837 |
|---|
| Catalog # | NBP1-55275-20ul |
|---|
| Price | |
|---|
| Order / More Info | UbcH5b/UBE2D2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|