| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | UbcH5b/UBE2D2 |
|---|
| Clone | 4A1 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunohistochemistry-Paraffin. Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P and ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The UbcH5b/UBE2D2 Antibody (4A1) from Novus Biologicals is a mouse monoclonal antibody to UbcH5b/UBE2D2. This antibody reacts with human, mouse, rat. The UbcH5b/UBE2D2 Antibody (4A1) has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | UBE2D2 (NP_003330, 1 a.a. - 94 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWS |
|---|
| Other Names | E2(17)KB2, EC 6.3.2.19, PUBC1, UBC4/5, UBC4ubiquitin-conjugating enzyme E2D 2 (homologous to yeast UBC4/5), UBC5B, UBCH4, UbcH5B, Ubiquitin carrier protein D2, ubiquitin-conjugating enzyme E2 D2, Ubiquitin-conjugating enzyme E2(17)KB 2, Ubiquitin-conjugating enzyme E2-17 kDa 2, ubiquitin-conjugating enzyme E2D 2 (UBC4/5 homolog, yeast), Ubiquitin-protein ligase D2 |
|---|
| Gene, Accession # | UBE2D2, Gene ID: 7322, Accession: NP_003330, SwissProt: NP_003330 |
|---|
| Catalog # | H00007322-M02 |
|---|
| Price | |
|---|
| Order / More Info | UbcH5b/UBE2D2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 20621683 |
|---|
| 产品资料 |
|
|