| 产品详情 |
| Edit |   |
| Antigenic Specificity | UbcH5b/UBE2D2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The UbcH5b/UBE2D2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to UbcH5b/UBE2D2. This antibody reacts with human, mouse, rat. The UbcH5b/UBE2D2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat UbcH5b/UBE2D2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LTDLQRDPPAQCSAGPVGDDLFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTKIYHPNINSNGSICLDILRS |
| Other Names | E2(17)KB2, EC 6.3.2.19, PUBC1, UBC4/5, UBC4ubiquitin-conjugating enzyme E2D 2 (homologous to yeast UBC4/5), UBC5B, UBCH4, UbcH5B, Ubiquitin carrier protein D2, ubiquitin-conjugating enzyme E2 D2, Ubiquitin-conjugating enzyme E2(17)KB 2, Ubiquitin-conjugating enzyme E2-17 kDa 2, ubiquitin-conjugating enzyme E2D 2 (UBC4/5 homolog, yeast), Ubiquitin-protein ligase D2 |
| Gene, Accession # | UBE2D2, Gene ID: 7322 |
| Catalog # | NBP1-81769 |
| Price | |
| Order / More Info | UbcH5b/UBE2D2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|