| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TFCP2L1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TFCP2L1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TFCP2L1. This antibody reacts with human. The TFCP2L1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human TFCP2L1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QVNSAPSPSYNGSPNSFGLGEGNASPTHPVEALPVGSDHLLPSASIQDAQQWLHRNRFSQ |
|---|
| Other Names | CRTR1CRTR-1, LBP-9, LBP9CP2-related transcriptional repressor 1, transcription factor CP2-like 1, transcription factor CP2-like protein 1, Transcription factor LBP-9 |
|---|
| Gene, Accession # | TFCP2L1, Gene ID: 29842 |
|---|
| Catalog # | NBP1-85441 |
|---|
| Price | |
|---|
| Order / More Info | TFCP2L1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 23227862, 30733432 |
|---|
| 产品资料 |
|
|